![]() | Class j: Peptides [58231] (151 folds) |
![]() | Fold j.106: Leucocin-like bacteriocin [100898] (1 superfamily) consists of a conserved, disulfide-containing N-terminal region (forming a beta-sheet) and a C-terminal helix |
![]() | Superfamily j.106.1: Leucocin-like bacteriocin [100899] (1 family) ![]() |
![]() | Family j.106.1.1: Leucocin-like bacteriocin [100900] (3 proteins) |
![]() | Protein Leucocin [58254] (1 species) antibacterial peptide, bacteriocin |
![]() | Species Leuconostoc gelidum [TaxId:1244] [58255] (3 PDB entries) |
![]() | Domain d1cw6a_: 1cw6 A: [46069] |
PDB Entry: 1cw6 (more details)
SCOPe Domain Sequences for d1cw6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cw6a_ j.106.1.1 (A:) Leucocin {Leuconostoc gelidum [TaxId: 1244]} kyygngvhctksgcsvnwgeafsagvhrlanggngfw
Timeline for d1cw6a_: