PDB entry 1cw6

View 1cw6 on RCSB PDB site
Description: refined solution structure of leucocin a
Class: toxin
Keywords: antimicrobial peptide, bacteriocin, toxin
Deposited on 1999-08-25, released 1999-09-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: type iia bacteriocin leucocin a
  Species: Leuconostoc gelidum [TaxId:1244]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P34034 (0-36)
  Domains in SCOPe 2.08: d1cw6a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cw6A (A:)
  kyygngvhctksgcsvnwgeafsagvhrlanggngfw