SCOP 1.75: Domain d1dyld_: 1dyl D:

Lineage for d1dyld_ (1dyl D:)

1. Root: SCOP 1.75

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)

4. Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family)

5. Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)

6. Protein SFV capsid [58173] (1 species)

7. Species Semliki forest virus [TaxId:11033] [58174] (1 PDB entry)

8. Domain d1dyld_: 1dyl D: [45966]

Details for d1dyld_

PDB Entry: 1dyl, 9 Å

PDB Description: 9 angstrom resolution cryo-em reconstruction structure of semliki forest virus (sfv) and fitting of the capsid protein structure in the em density

PDB Compounds: (D:) nucleocapsid protein

SCOP Domain Sequences for d1dyld_:

Sequence; same for both SEQRES and ATOM records:

>d1dyld_ i.6.1.1 (D:) SFV capsid {Semliki forest virus [TaxId: 11033]}
cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
negsrtalsvvtwnkdmvtrvtpegseew

Timeline for d1dyld_:

• d1dyld_ first appeared (with stable ids) in SCOP 1.55
  
• d1dyld_ appears in SCOP 1.73
  
• d1dyld_ appears in SCOPe 2.01
  
• d1dyld_ appears in the current release, SCOPe 2.08