SCOP 1.55: Domain d1dyld_: 1dyl D:

Lineage for d1dyld_ (1dyl D:)

1. Root: SCOP 1.55
2. Class i: Low resolution protein structures [58117] (12 folds)
3. Fold i.6: Virus and virus-receptor complexes [58162] (1 superfamily)
4. Superfamily i.6.1: Virus and virus-receptor complexes [58163] (1 family)
5. Family i.6.1.1: Virus and virus-receptor complexes [58164] (5 proteins)
6. Protein SFV capsid [58173] (1 species)
7. Species Semliki forest virus [TaxId:11033] [58174] (1 PDB entry)
8. Domain d1dyld_: 1dyl D: [45966]

Details for d1dyld_

PDB Entry: 1dyl, 9 Å

PDB Description: 9 angstrom resolution cryo-em reconstruction structure of semliki forest virus (sfv) and fitting of the capsid protein structure in the em density

SCOP Domain Sequences for d1dyld_:

Sequence; same for both SEQRES and ATOM records:

>d1dyld_ i.6.1.1 (D:) SFV capsid {Semliki forest virus}
cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
negsrtalsvvtwnkdmvtrvtpegseew

SCOP Domain Coordinates for d1dyld_ are not available.

Timeline for d1dyld_:

• d1dyld_ appears in SCOP 1.57
  
• d1dyld_ appears in the current release, SCOPe 2.08