Lineage for d1dyld_ (1dyl D:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3044501Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 3044502Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 3044503Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)
  6. 3044642Protein SFV capsid [58173] (1 species)
  7. 3044643Species Semliki forest virus [TaxId:11033] [58174] (1 PDB entry)
  8. 3044647Domain d1dyld_: 1dyl D: [45966]

Details for d1dyld_

PDB Entry: 1dyl (more details), 9 Å

PDB Description: 9 angstrom resolution cryo-em reconstruction structure of semliki forest virus (sfv) and fitting of the capsid protein structure in the em density
PDB Compounds: (D:) nucleocapsid protein

SCOPe Domain Sequences for d1dyld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dyld_ i.6.1.1 (D:) SFV capsid {Semliki forest virus [TaxId: 11033]}
cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
negsrtalsvvtwnkdmvtrvtpegseew

SCOPe Domain Coordinates for d1dyld_:

Click to download the PDB-style file with coordinates for d1dyld_.
(The format of our PDB-style files is described here.)

Timeline for d1dyld_: