![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily) |
![]() | Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) ![]() |
![]() | Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins) |
![]() | Protein SFV capsid [58173] (1 species) |
![]() | Species Semliki forest virus [TaxId:11033] [58174] (1 PDB entry) |
![]() | Domain d1dylc_: 1dyl C: [45965] |
PDB Entry: 1dyl (more details), 9 Å
SCOPe Domain Sequences for d1dylc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dylc_ i.6.1.1 (C:) SFV capsid {Semliki forest virus [TaxId: 11033]} cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga negsrtalsvvtwnkdmvtrvtpegseew
Timeline for d1dylc_: