PDB entry 1dyl

View 1dyl on RCSB PDB site
Description: 9 angstrom resolution cryo-em reconstruction structure of semliki forest virus (sfv) and fitting of the capsid protein structure in the em density
Class: virus/viral protein
Keywords: VIRUS/VIRAL PROTEIN, ALPHAVIRUS, SFV, CRYO-EM, IMAGE RECONSTRUCTION, ENVELOPED VIRUS, CAPSID PROTEIN, ICOSAHEDRAL VIRUS, VIRUS-VIRAL PROTEIN complex
Deposited on 2000-02-02, released 2000-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: EM
Resolution: 9 Å
R-factor: N/A
AEROSPACI score: -0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleocapsid protein
    Species: SEMLIKI FOREST VIRUS [TaxId:11033]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dyla_
  • Chain 'B':
    Compound: nucleocapsid protein
    Species: SEMLIKI FOREST VIRUS [TaxId:11033]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dylb_
  • Chain 'C':
    Compound: nucleocapsid protein
    Species: SEMLIKI FOREST VIRUS [TaxId:11033]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dylc_
  • Chain 'D':
    Compound: nucleocapsid protein
    Species: SEMLIKI FOREST VIRUS [TaxId:11033]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dyld_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dylA (A:)
    cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
    sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
    negsrtalsvvtwnkdmvtrvtpegseew
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dylB (B:)
    cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
    sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
    negsrtalsvvtwnkdmvtrvtpegseew
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dylC (C:)
    cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
    sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
    negsrtalsvvtwnkdmvtrvtpegseew
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dylD (D:)
    cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
    sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
    negsrtalsvvtwnkdmvtrvtpegseew