SCOP 1.63: Domain d1dgi4_: 1dgi 4:

Lineage for d1dgi4_ (1dgi 4:)

1. Root: SCOP 1.63

2. Class i: Low resolution protein structures [58117] (18 folds)

3. Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)

4. Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family)

5. Family i.6.1.1: Viruses and virus-receptor complexes [58164] (11 proteins)

6. Protein Poliovirus complexed with three domain CD155 [58169] (1 species)

7. Species Human poliovirus type 1 [TaxId:12080] [58170] (1 PDB entry)

8. Domain d1dgi4_: 1dgi 4: [45957]

Details for d1dgi4_

PDB Entry: 1dgi

PDB Description: cryo-em structure of human poliovirus(serotype 1)complexed with three domain cd155

SCOP Domain Sequences for d1dgi4_:

Sequence; same for both SEQRES and ATOM records:

>d1dgi4_ i.6.1.1 (4:) Poliovirus complexed with three domain CD155 {Human poliovirus type 1}
gaqvssqkvgahensstinyttinyyrdsasnaaskqdfsqdpskftepikdvliktapm
ln

Timeline for d1dgi4_:

• d1dgi4_ first appeared (with stable ids) in SCOP 1.55
  
• d1dgi4_ appears in SCOP 1.61
  
• d1dgi4_ appears in SCOP 1.65
  
• d1dgi4_ appears in the current release, SCOPe 2.08