Lineage for d1dgir_ (1dgi R:)

  1. Root: SCOP 1.63
  2. 272796Class i: Low resolution protein structures [58117] (18 folds)
  3. 273319Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 273320Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 273321Family i.6.1.1: Viruses and virus-receptor complexes [58164] (11 proteins)
  6. 273429Protein Poliovirus complexed with three domain CD155 [58169] (1 species)
  7. 273430Species Human poliovirus type 1 [TaxId:12080] [58170] (1 PDB entry)
  8. 273435Domain d1dgir_: 1dgi R: [45953]

Details for d1dgir_

PDB Entry: 1dgi (more details)

PDB Description: cryo-em structure of human poliovirus(serotype 1)complexed with three domain cd155

SCOP Domain Sequences for d1dgir_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgir_ i.6.1.1 (R:) Poliovirus complexed with three domain CD155 {Human poliovirus type 1}
vvvqaptqvpgflgdsvtlpcylqvpnmevthvsqltwarhgesgsmavfhqtqgpsyse
skrlefvaarlgaelrnaslrmfglrvedegnytclfvtfpqgsrsvdiwlrvlakpqnt
aevqkvqltgepvpmarcvstggrppaqitwhsdlggmpntsqvpgflsgtvtvtslwil
vpssqvdgknvtckvehesfekpqlltvnltvyyppevsisgydnnwylgqneatltcda
rsnpeptgynwsttmgplppfavaqgaqllirpvdkpinttlicnvtnalgarqaeltvq
v

SCOP Domain Coordinates for d1dgir_:

Click to download the PDB-style file with coordinates for d1dgir_.
(The format of our PDB-style files is described here.)

Timeline for d1dgir_: