| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily) |
Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) ![]() |
| Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins) |
| Protein HRV14 complexed with d1d2-ICAM-1 [58167] (1 species) |
| Species Human rhinovirus 14 [TaxId:12131] [58168] (1 PDB entry) |
| Domain d1d3i3_: 1d3i 3: [45951] |
PDB Entry: 1d3i (more details), 26 Å
SCOPe Domain Sequences for d1d3i3_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d3i3_ i.6.1.1 (3:) HRV14 complexed with d1d2-ICAM-1 {Human rhinovirus 14 [TaxId: 12131]}
glptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnntht
kdevnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgp
alssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvqfrytdpdt
ytsagflscwyqtslilppettgqvyllsfisacpdfklrlmkdtqtisqtvalte
Timeline for d1d3i3_:
View in 3DDomains from other chains: (mouse over for more information) d1d3i1_, d1d3i2_, d1d3i4_, d1d3ii_ |