SCOP 1.55: Domain d1d3i3_: 1d3i 3:

Lineage for d1d3i3_ (1d3i 3:)

1. Root: SCOP 1.55
2. Class i: Low resolution protein structures [58117] (12 folds)
3. Fold i.6: Virus and virus-receptor complexes [58162] (1 superfamily)
4. Superfamily i.6.1: Virus and virus-receptor complexes [58163] (1 family)
5. Family i.6.1.1: Virus and virus-receptor complexes [58164] (5 proteins)
6. Protein HRV14 complexed with d1d2-ICAM-1 [58167] (1 species)
7. Species Human rhinovirus 14 [TaxId:12131] [58168] (1 PDB entry)
8. Domain d1d3i3_: 1d3i 3: [45951]

Details for d1d3i3_

PDB Entry: 1d3i

PDB Description: cryo-em structure of human rhinovirus 14 (hrv14) complexed with a two- domain fragment of its cellular receptor, intercellular adhesion molecule-1 (d1d2-icam-1). implications for virus-receptor interactions. alpha carbons only

SCOP Domain Sequences for d1d3i3_:

Sequence; same for both SEQRES and ATOM records:

>d1d3i3_ i.6.1.1 (3:) HRV14 complexed with d1d2-ICAM-1 {Human rhinovirus 14}
glptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnntht
kdevnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgp
alssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvqfrytdpdt
ytsagflscwyqtslilppettgqvyllsfisacpdfklrlmkdtqtisqtvalte

SCOP Domain Coordinates for d1d3i3_ are not available.

Timeline for d1d3i3_:

• d1d3i3_ appears in SCOP 1.57
  
• d1d3i3_ appears in the current release, SCOPe 2.08