Lineage for d1d3i3_ (1d3i 3:)

  1. Root: SCOP 1.63
  2. 272796Class i: Low resolution protein structures [58117] (18 folds)
  3. 273319Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 273320Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 273321Family i.6.1.1: Viruses and virus-receptor complexes [58164] (11 proteins)
  6. 273351Protein HRV14 complexed with d1d2-ICAM-1 [58167] (1 species)
  7. 273352Species Human rhinovirus 14 [TaxId:12131] [58168] (1 PDB entry)
  8. 273355Domain d1d3i3_: 1d3i 3: [45951]

Details for d1d3i3_

PDB Entry: 1d3i (more details)

PDB Description: cryo-em structure of human rhinovirus 14 (hrv14) complexed with a two- domain fragment of its cellular receptor, intercellular adhesion molecule-1 (d1d2-icam-1). implications for virus-receptor interactions. alpha carbons only

SCOP Domain Sequences for d1d3i3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3i3_ i.6.1.1 (3:) HRV14 complexed with d1d2-ICAM-1 {Human rhinovirus 14}
glptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnntht
kdevnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgp
alssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvqfrytdpdt
ytsagflscwyqtslilppettgqvyllsfisacpdfklrlmkdtqtisqtvalte

SCOP Domain Coordinates for d1d3i3_:

Click to download the PDB-style file with coordinates for d1d3i3_.
(The format of our PDB-style files is described here.)

Timeline for d1d3i3_: