Lineage for d1qd7e_ (1qd7 E:)

  1. Root: SCOP 1.59
  2. 146111Class i: Low resolution protein structures [58117] (16 folds)
  3. 146112Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 146113Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 146400Family i.1.1.3: Small subunit [58132] (1 protein)
  6. 146401Protein 30S subunit [58133] (1 species)
  7. 146402Species Thermus thermophilus [TaxId:274] [58134] (4 PDB entries)
  8. 146430Domain d1qd7e_: 1qd7 E: [45868]

Details for d1qd7e_

PDB Entry: 1qd7 (more details), 5.5 Å

PDB Description: partial model for 30s ribosomal subunit

SCOP Domain Sequences for d1qd7e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qd7e_ i.1.1.3 (E:) 30S subunit {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepf

SCOP Domain Coordinates for d1qd7e_:

Click to download the PDB-style file with coordinates for d1qd7e_.
(The format of our PDB-style files is described here.)

Timeline for d1qd7e_: