SCOP 1.59: Domain d1qd7c_: 1qd7 C:

Lineage for d1qd7c_ (1qd7 C:)

1. Root: SCOP 1.59

2. Class i: Low resolution protein structures [58117] (16 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.3: Small subunit [58132] (1 protein)

6. Protein 30S subunit [58133] (1 species)

7. Species Thermus thermophilus [TaxId:274] [58134] (4 PDB entries)

8. Domain d1qd7c_: 1qd7 C: [45866]

Details for d1qd7c_

PDB Entry: 1qd7, 5.5 Å

PDB Description: partial model for 30s ribosomal subunit

SCOP Domain Sequences for d1qd7c_:

Sequence; same for both SEQRES and ATOM records:

>d1qd7c_ i.1.1.3 (C:) 30S subunit {Thermus thermophilus}
mklseyglqlqekqklrhmygvnerqfrktfeeagkmpgkhgenfmillesrldnlvyrl
glartrrqarqlvthghilvdgsrvnipsyrvkpgqtiavreksrnlqvikealeannyi
pdylsfdpekmegtytrlperselpaeinealivefysr

Timeline for d1qd7c_:

• d1qd7c_ first appeared (with stable ids) in SCOP 1.55
  
• d1qd7c_ appears in SCOP 1.57
  
• d1qd7c_ appears in SCOP 1.61
  
• d1qd7c_ appears in the current release, SCOPe 2.08, called d1qd7c1