Lineage for d1c04d_ (1c04 D:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 627045Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 627046Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 627824Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 627828Protein 50S subunit [58125] (3 species)
  7. 627829Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (4 PDB entries)
  8. 627862Domain d1c04d_: 1c04 D: [45830]

Details for d1c04d_

PDB Entry: 1c04 (more details), 5 Å

PDB Description: identification of known protein and rna structures in a 5 a map of the large ribosomal subunit from haloarcula marismortui

SCOP Domain Sequences for d1c04d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c04d_ i.1.1.2 (D:) 50S subunit {Archaeon Haloarcula marismortui}
miqqesrlkvadnsgarevlvikvlggsgrryanigdvvvatvkdatpggvvkkgqvvka
vvvrtkrgvrrpdgsyirfdenacviirddksprgtrifgpvarelrdkdfmkiislape
vi

SCOP Domain Coordinates for d1c04d_:

Click to download the PDB-style file with coordinates for d1c04d_.
(The format of our PDB-style files is described here.)

Timeline for d1c04d_: