SCOP 1.55: Domain d1c04d_: 1c04 D:

Lineage for d1c04d_ (1c04 D:)

1. Root: SCOP 1.55
2. Class i: Low resolution protein structures [58117] (12 folds)
3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)
5. Family i.1.1.2: Large subunit [58124] (3 proteins)
6. Protein 50S subunit [58125] (2 species)
7. Species Haloarcula marismortui [TaxId:2238] [58126] (3 PDB entries)
8. Domain d1c04d_: 1c04 D: [45830]

Details for d1c04d_

PDB Entry: 1c04, 5 Å

PDB Description: identification of known protein and rna structures in a 5 a map of the large ribosomal subunit from haloarcula marismortui

SCOP Domain Sequences for d1c04d_:

Sequence; same for both SEQRES and ATOM records:

>d1c04d_ i.1.1.2 (D:) 50S subunit {Haloarcula marismortui}
miqqesrlkvadnsgarevlvikvlggsgrryanigdvvvatvkdatpggvvkkgqvvka
vvvrtkrgvrrpdgsyirfdenacviirddksprgtrifgpvarelrdkdfmkiislape
vi

SCOP Domain Coordinates for d1c04d_ are not available.

Timeline for d1c04d_:

• d1c04d_ appears in SCOP 1.57
  
• d1c04d_ appears in the current release, SCOPe 2.08