Lineage for d2eboc_ (2ebo C:)

  1. Root: SCOP 1.57
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
  4. Superfamily h.3.2: Virus ectodomain [58069] (1 family) (S)
  5. Family h.3.2.1: Virus ectodomain [58070] (5 proteins)
  6. Protein Core structure of Ebo gp2 [58076] (1 species)
  7. Species Ebola virus [TaxId:205488] [58077] (2 PDB entries)
  8. Domain d2eboc_: 2ebo C: [45756]

Details for d2eboc_

PDB Entry: 2ebo (more details), 1.9 Å

PDB Description: core structure of gp2 from ebola virus

SCOP Domain Sequences for d2eboc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eboc_ h.3.2.1 (C:) Core structure of Ebo gp2 {Ebola virus}
glrqlanettqalqlflrattelrtfsilnrkaidfllqrwggtchilgpdcaiephdwt
knitdkidqiihdf

SCOP Domain Coordinates for d2eboc_ are not available.

Timeline for d2eboc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2eboa_, d2ebob_