Lineage for d2eboc_ (2ebo C:)

  1. Root: SCOP 1.59
  2. 145365Class h: Coiled coil proteins [57942] (5 folds)
  3. 145868Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
  4. 145929Superfamily h.3.2: Virus ectodomain [58069] (1 family) (S)
  5. 145930Family h.3.2.1: Virus ectodomain [58070] (6 proteins)
  6. 145931Protein Core structure of Ebo gp2 [58076] (1 species)
  7. 145932Species Ebola virus [TaxId:205488] [58077] (2 PDB entries)
  8. 145935Domain d2eboc_: 2ebo C: [45756]

Details for d2eboc_

PDB Entry: 2ebo (more details), 1.9 Å

PDB Description: core structure of gp2 from ebola virus

SCOP Domain Sequences for d2eboc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eboc_ h.3.2.1 (C:) Core structure of Ebo gp2 {Ebola virus}
glrqlanettqalqlflrattelrtfsilnrkaidfllqrwggtchilgpdcaiephdwt
knitdkidqiihdf

SCOP Domain Coordinates for d2eboc_:

Click to download the PDB-style file with coordinates for d2eboc_.
(The format of our PDB-style files is described here.)

Timeline for d2eboc_: