PDB entry 2ebo
View 2ebo on RCSB PDB site
Description: core structure of gp2 from ebola virus
Deposited on
1998-12-24, released
1999-05-18
The last revision was dated
2018-03-14, with a file datestamp of
2018-03-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.46
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ebola virus envelope glycoprotein
Species: Zaire ebolavirus [TaxId:128952]
Gene: GP41
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: ebola virus envelope glycoprotein
Species: Zaire ebolavirus [TaxId:128952]
Gene: GP41
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: ebola virus envelope glycoprotein
Species: Zaire ebolavirus [TaxId:128952]
Gene: GP41
Database cross-references and differences (RAF-indexed):
- Heterogens: CL, HOH
PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.57, so the chain sequences below are not included in the ASTRAL sequence sets.
- Chain 'A':
Sequence; same for both SEQRES and ATOM records:
>2eboA (A:)
glrqlanettqalqlflrattelrtfsilnrkaidfllqrwggtchilgpdcaiephdwt
knitdkidqiihdf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records:
>2eboB (B:)
glrqlanettqalqlflrattelrtfsilnrkaidfllqrwggtchilgpdcaiephdwt
knitdkidqiihdf
- Chain 'C':
Sequence; same for both SEQRES and ATOM records:
>2eboC (C:)
glrqlanettqalqlflrattelrtfsilnrkaidfllqrwggtchilgpdcaiephdwt
knitdkidqiihdf