SCOPe 2.08: Domain d1fzaf2: 1fza F:88-141

Lineage for d1fzaf2 (1fza F:88-141)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen gamma chain [88898] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries)
   Uniprot P02679

8. Domain d1fzaf2: 1fza F:88-141 [45625]
   Other proteins in same PDB: d1fzaa_, d1fzab1, d1fzab2, d1fzac1, d1fzad_, d1fzae1, d1fzae2, d1fzaf1
   coiled-coil region only
   complexed with ca, nag

Details for d1fzaf2

PDB Entry: 1fza, 2.9 Å

PDB Description: crystal structure of fibrinogen fragment d

PDB Compounds: (F:) fibrinogen

SCOPe Domain Sequences for d1fzaf2:

Sequence; same for both SEQRES and ATOM records:

>d1fzaf2 h.1.8.1 (F:88-141) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]}
kmleeimkyeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckd

Timeline for d1fzaf2:

• d1fzaf2 first appeared (with stable ids) in SCOP 1.55
  
• d1fzaf2 appears in SCOPe 2.07