SCOPe 2.08: Domain d1fzae2: 1fza E:148-199

Lineage for d1fzae2 (1fza E:148-199)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen beta chain [88892] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries)
   Uniprot P02675

8. Domain d1fzae2: 1fza E:148-199 [45624]
   Other proteins in same PDB: d1fzaa_, d1fzab1, d1fzac1, d1fzac2, d1fzad_, d1fzae1, d1fzaf1, d1fzaf2
   coiled-coil region only
   complexed with ca, nag

Details for d1fzae2

PDB Entry: 1fza, 2.9 Å

PDB Description: crystal structure of fibrinogen fragment d

PDB Compounds: (E:) fibrinogen

SCOPe Domain Sequences for d1fzae2:

Sequence; same for both SEQRES and ATOM records:

>d1fzae2 h.1.8.1 (E:148-199) Fibrinogen beta chain {Human (Homo sapiens) [TaxId: 9606]}
khqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv

Timeline for d1fzae2:

• d1fzae2 first appeared (with stable ids) in SCOP 1.55
  
• d1fzae2 appears in SCOPe 2.07