Lineage for d1fzab2 (1fza B:148-199)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.1: Parallel coiled-coil [57943] (19 superfamilies)
  4. Superfamily h.1.8: Fibrinogen coiled-coil region [58010] (1 family) (S)
  5. Family h.1.8.1: Fibrinogen coiled-coil region [58011] (1 protein)
  6. Protein Fibrinogen coiled-coil region [58012] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [58013] (6 PDB entries)
  8. 42199Domain d1fzab2: 1fza B:148-199 [45621]
    Other proteins in same PDB: d1fzab1, d1fzac1, d1fzae1, d1fzaf1

Details for d1fzab2

PDB Entry: 1fza (more details), 2.9 Å

PDB Description: crystal structure of fibrinogen fragment d

SCOP Domain Sequences for d1fzab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzab2 h.1.8.1 (B:148-199) Fibrinogen coiled-coil region {Human (Homo sapiens)}
khqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv

SCOP Domain Coordinates for d1fzab2:

Click to download the PDB-style file with coordinates for d1fzab2.
(The format of our PDB-style files is described here.)

Timeline for d1fzab2: