Lineage for d1fzgf2 (1fzg F:109-141)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.1: Parallel coiled-coil [57943] (19 superfamilies)
  4. Superfamily h.1.8: Fibrinogen coiled-coil region [58010] (1 family) (S)
  5. Family h.1.8.1: Fibrinogen coiled-coil region [58011] (1 protein)
  6. Protein Fibrinogen coiled-coil region [58012] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [58013] (6 PDB entries)
  8. 42185Domain d1fzgf2: 1fzg F:109-141 [45607]
    Other proteins in same PDB: d1fzgb1, d1fzgc1, d1fzge1, d1fzgf1

Details for d1fzgf2

PDB Entry: 1fzg (more details), 2.5 Å

PDB Description: crystal structure of fragment d from human fibrinogen with the peptide ligand gly-his-arg-pro-amide

SCOP Domain Sequences for d1fzgf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzgf2 h.1.8.1 (F:109-141) Fibrinogen coiled-coil region {Human (Homo sapiens)}
ylqeiynsnnqkivnlkekvaqleaqcqepckd

SCOP Domain Coordinates for d1fzgf2:

Click to download the PDB-style file with coordinates for d1fzgf2.
(The format of our PDB-style files is described here.)

Timeline for d1fzgf2:

42185
d1fzgf2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1fzgf1