Lineage for d1fzfe2 (1fzf E:164-199)

  1. Root: SCOP 1.63
  2. 271841Class h: Coiled coil proteins [57942] (6 folds)
  3. 271842Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 272214Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 272215Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein)
  6. 272216Protein Fibrinogen coiled-coil and central regions [58012] (4 species)
    in the central region two tripple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  7. 272237Species Human (Homo sapiens) [TaxId:9606] [58013] (10 PDB entries)
  8. 272254Domain d1fzfe2: 1fzf E:164-199 [45600]
    Other proteins in same PDB: d1fzfb1, d1fzfc1, d1fzfe1, d1fzff1

Details for d1fzfe2

PDB Entry: 1fzf (more details), 2.7 Å

PDB Description: crystal structure of fragment double-d from human fibrin with the peptide ligand gly-his-arg-pro-amide

SCOP Domain Sequences for d1fzfe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzfe2 h.1.8.1 (E:164-199) Fibrinogen coiled-coil and central regions {Human (Homo sapiens)}
nlrvlrsilenlrskiqklesdvsaqmeycrtpctv

SCOP Domain Coordinates for d1fzfe2:

Click to download the PDB-style file with coordinates for d1fzfe2.
(The format of our PDB-style files is described here.)

Timeline for d1fzfe2: