![]() | Class h: Coiled coil proteins [57942] (6 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (22 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) ![]() |
![]() | Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein) |
![]() | Protein Fibrinogen coiled-coil and central regions [58012] (4 species) in the central region two tripple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
![]() | Species Human (Homo sapiens) [TaxId:9606] [58013] (10 PDB entries) |
![]() | Domain d1fzfb2: 1fzf B:157-199 [45597] Other proteins in same PDB: d1fzfb1, d1fzfc1, d1fzfe1, d1fzff1 |
PDB Entry: 1fzf (more details), 2.7 Å
SCOP Domain Sequences for d1fzfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fzfb2 h.1.8.1 (B:157-199) Fibrinogen coiled-coil and central regions {Human (Homo sapiens)} vnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv
Timeline for d1fzfb2: