Lineage for d1fbme_ (1fbm E:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039909Superfamily h.1.7: Assembly domain of cartilage oligomeric matrix protein [58006] (1 family) (S)
  5. 3039910Family h.1.7.1: Assembly domain of cartilage oligomeric matrix protein [58007] (1 protein)
  6. 3039911Protein Assembly domain of cartilage oligomeric matrix protein [58008] (1 species)
    pentameric coiled-coil
  7. 3039912Species Norway rat (Rattus norvegicus) [TaxId:10116] [58009] (7 PDB entries)
  8. 3039947Domain d1fbme_: 1fbm E: [45589]
    complex with all-trans retinol
    complexed with rtl

Details for d1fbme_

PDB Entry: 1fbm (more details), 2.7 Å

PDB Description: assembly domain of cartilage oligomeric matrix protein in complex with all-trans retinol
PDB Compounds: (E:) protein (cartilage oligomeric matrix protein)

SCOPe Domain Sequences for d1fbme_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbme_ h.1.7.1 (E:) Assembly domain of cartilage oligomeric matrix protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg

SCOPe Domain Coordinates for d1fbme_:

Click to download the PDB-style file with coordinates for d1fbme_.
(The format of our PDB-style files is described here.)

Timeline for d1fbme_: