PDB entry 1fbm

View 1fbm on RCSB PDB site
Description: assembly domain of cartilage oligomeric matrix protein in complex with all-trans retinol
Class: cell adhesion
Keywords: extracellular matrix protein, assembly domain, cartilage, oligomeric matrix protein, glycoprotein, retinol-complex, cell adhesion
Deposited on 2000-07-16, released 2000-08-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cartilage oligomeric matrix protein)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35444 (0-45)
      • conflict (0)
      • conflict (26-27)
    Domains in SCOPe 2.08: d1fbma_
  • Chain 'B':
    Compound: protein (cartilage oligomeric matrix protein)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35444 (0-45)
      • conflict (0)
      • conflict (26-27)
    Domains in SCOPe 2.08: d1fbmb_
  • Chain 'C':
    Compound: protein (cartilage oligomeric matrix protein)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35444 (0-45)
      • conflict (0)
      • conflict (26-27)
    Domains in SCOPe 2.08: d1fbmc_
  • Chain 'D':
    Compound: protein (cartilage oligomeric matrix protein)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35444 (0-45)
      • conflict (0)
      • conflict (26-27)
    Domains in SCOPe 2.08: d1fbmd_
  • Chain 'E':
    Compound: protein (cartilage oligomeric matrix protein)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35444 (0-45)
      • conflict (0)
      • conflict (26-27)
    Domains in SCOPe 2.08: d1fbme_
  • Heterogens: RTL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbmA (A:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbmB (B:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbmC (C:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbmD (D:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbmE (E:)
    mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdacg