Lineage for d1pyia2 (1pyi A:72-117)

  1. Root: SCOP 1.59
  2. 145365Class h: Coiled coil proteins [57942] (5 folds)
  3. 145366Fold h.1: Parallel coiled-coil [57943] (21 superfamilies)
  4. 145470Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 145471Family h.1.3.1: Leucine zipper domain [57960] (13 proteins)
  6. 145606Protein PPR1 [57965] (1 species)
  7. 145607Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57966] (1 PDB entry)
  8. 145608Domain d1pyia2: 1pyi A:72-117 [45512]
    Other proteins in same PDB: d1pyia1, d1pyib1

Details for d1pyia2

PDB Entry: 1pyi (more details), 3.2 Å

PDB Description: crystal structure of a ppr1-dna complex: dna recognition by proteins containing a zn2cys6 binuclear cluster

SCOP Domain Sequences for d1pyia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pyia2 h.1.3.1 (A:72-117) PPR1 {Baker's yeast (Saccharomyces cerevisiae)}
vprsyvffledrlavmmrvlkeygvdptkirgnipatsddepfdlk

SCOP Domain Coordinates for d1pyia2:

Click to download the PDB-style file with coordinates for d1pyia2.
(The format of our PDB-style files is described here.)

Timeline for d1pyia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pyia1