SCOPe 2.08: Domain d1pyia2: 1pyi A:72-117

Lineage for d1pyia2 (1pyi A:72-117)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.3: Leucine zipper domain [57959] (2 families)

5. Family h.1.3.1: Leucine zipper domain [57960] (17 proteins)

6. Protein PPR1 [57965] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57966] (1 PDB entry)

8. Domain d1pyia2: 1pyi A:72-117 [45512]
   Other proteins in same PDB: d1pyia1, d1pyib1
   protein/DNA complex; complexed with zn

Details for d1pyia2

PDB Entry: 1pyi, 3.2 Å

PDB Description: crystal structure of a ppr1-dna complex: dna recognition by proteins containing a zn2cys6 binuclear cluster

PDB Compounds: (A:) protein (pyrimidine pathway regulator 1)

SCOPe Domain Sequences for d1pyia2:

Sequence; same for both SEQRES and ATOM records:

>d1pyia2 h.1.3.1 (A:72-117) PPR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vprsyvffledrlavmmrvlkeygvdptkirgnipatsddepfdlk

Timeline for d1pyia2:

• d1pyia2 first appeared (with stable ids) in SCOP 1.55
  
• d1pyia2 appears in SCOPe 2.07