Lineage for d1flkb2 (1flk B:300-349)

  1. Root: SCOPe 2.01
  2. 1067937Class h: Coiled coil proteins [57942] (7 folds)
  3. 1067938Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1068065Superfamily h.1.2: Trimerization domain of TRAF [57953] (1 family) (S)
  5. 1068066Family h.1.2.1: Trimerization domain of TRAF [57954] (2 proteins)
  6. 1068117Protein TRAF3 [57957] (1 species)
  7. 1068118Species Human (Homo sapiens) [TaxId:9606] [57958] (5 PDB entries)
    Uniprot Q13114 377-568
  8. 1068121Domain d1flkb2: 1flk B:300-349 [45470]
    Other proteins in same PDB: d1flka1, d1flkb1

Details for d1flkb2

PDB Entry: 1flk (more details), 2.8 Å

PDB Description: molecular basis for cd40 signaling mediated by traf3
PDB Compounds: (B:) tnf receptor associated factor 3

SCOPe Domain Sequences for d1flkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flkb2 h.1.2.1 (B:300-349) TRAF3 {Human (Homo sapiens) [TaxId: 9606]}
lesvdksagqvarntgllesqlsrhdqmlsvhdirladmdlrfqvletas

SCOPe Domain Coordinates for d1flkb2:

Click to download the PDB-style file with coordinates for d1flkb2.
(The format of our PDB-style files is described here.)

Timeline for d1flkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1flkb1