Lineage for d1flkb2 (1flk B:300-349)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.1: Parallel coiled-coil [57943] (19 superfamilies)
  4. 41944Superfamily h.1.2: Trimerization domain of TRAF [57953] (1 family) (S)
  5. 41945Family h.1.2.1: Trimerization domain of TRAF [57954] (2 proteins)
  6. 41990Protein TRAF3 [57957] (1 species)
  7. 41991Species Human (Homo sapiens) [TaxId:9606] [57958] (2 PDB entries)
  8. 41993Domain d1flkb2: 1flk B:300-349 [45470]
    Other proteins in same PDB: d1flka1, d1flkb1

Details for d1flkb2

PDB Entry: 1flk (more details), 2.8 Å

PDB Description: molecular basis for cd40 signaling mediated by traf3

SCOP Domain Sequences for d1flkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flkb2 h.1.2.1 (B:300-349) TRAF3 {Human (Homo sapiens)}
lesvdksagqvarntgllesqlsrhdqmlsvhdirladmdlrfqvletas

SCOP Domain Coordinates for d1flkb2:

Click to download the PDB-style file with coordinates for d1flkb2.
(The format of our PDB-style files is described here.)

Timeline for d1flkb2:

41993
d1flkb2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1flkb1