Class g: Small proteins [56992] (90 folds) |
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) |
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
Protein BIR domains of XIAP [57928] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57929] (13 PDB entries) Uniprot P98170 241-356 |
Domain d1c9qa_: 1c9q A: [45377] BIR2 domain complexed with zn |
PDB Entry: 1c9q (more details)
SCOPe Domain Sequences for d1c9qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c9qa_ g.52.1.1 (A:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} rdhfaldrpsethadyllrtgqvvdisdtiyprnpamyseearlksfqnwpdyahltpre lasaglyytgigdqvqcfacggklknwepgdrawsehrrhfpncffvlgrnlnirse
Timeline for d1c9qa_: