SCOPe 2.03: Domain d1c9qa_: 1c9q A:

Lineage for d1c9qa_ (1c9q A:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein BIR domains of XIAP [57928] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57929] (13 PDB entries)
   Uniprot P98170 241-356

8. Domain d1c9qa_: 1c9q A: [45377]
   BIR2 domain
   complexed with zn

Details for d1c9qa_

PDB Entry: 1c9q

PDB Description: average nmr solution structure of the bir-2 domain of xiap

PDB Compounds: (A:) apoptosis inhibitor iap homolog

SCOPe Domain Sequences for d1c9qa_:

Sequence; same for both SEQRES and ATOM records:

>d1c9qa_ g.52.1.1 (A:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
rdhfaldrpsethadyllrtgqvvdisdtiyprnpamyseearlksfqnwpdyahltpre
lasaglyytgigdqvqcfacggklknwepgdrawsehrrhfpncffvlgrnlnirse

Timeline for d1c9qa_:

• d1c9qa_ first appeared (with stable ids) in SCOP 1.55
  
• d1c9qa_ appears in SCOPe 2.02
  
• d1c9qa_ appears in SCOPe 2.04
  
• d1c9qa_ appears in the current release, SCOPe 2.08