Lineage for d1c9qa_ (1c9q A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41861Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
  4. 41862Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) (S)
  5. 41863Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (3 proteins)
  6. 41873Protein BIR domains of XIAP [57928] (1 species)
  7. 41874Species Human (Homo sapiens) [TaxId:9606] [57929] (3 PDB entries)
  8. 41877Domain d1c9qa_: 1c9q A: [45377]

Details for d1c9qa_

PDB Entry: 1c9q (more details)

PDB Description: average nmr solution structure of the bir-2 domain of xiap

SCOP Domain Sequences for d1c9qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9qa_ g.52.1.1 (A:) BIR domains of XIAP {Human (Homo sapiens)}
rdhfaldrpsethadyllrtgqvvdisdtiyprnpamyseearlksfqnwpdyahltpre
lasaglyytgigdqvqcfacggklknwepgdrawsehrrhfpncffvlgrnlnirse

SCOP Domain Coordinates for d1c9qa_:

Click to download the PDB-style file with coordinates for d1c9qa_.
(The format of our PDB-style files is described here.)

Timeline for d1c9qa_: