![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
![]() | Family g.44.1.1: RING finger domain, C3HC4 [57851] (14 proteins) |
![]() | Protein TFIIH Mat1 subunit [57860] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57861] (1 PDB entry) |
![]() | Domain d1g25a_: 1g25 A: [45325] complexed with zn |
PDB Entry: 1g25 (more details)
SCOPe Domain Sequences for d1g25a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} mddqgcprckttkyrnpslklmvnvcghtlcescvdllfvrgagncpecgtplrksnfrv qlfed
Timeline for d1g25a_: