Lineage for d1g25a_ (1g25 A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1245811Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 1245812Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 1245813Family g.44.1.1: RING finger domain, C3HC4 [57851] (14 proteins)
  6. 1245854Protein TFIIH Mat1 subunit [57860] (1 species)
  7. 1245855Species Human (Homo sapiens) [TaxId:9606] [57861] (1 PDB entry)
  8. 1245856Domain d1g25a_: 1g25 A: [45325]
    complexed with zn

Details for d1g25a_

PDB Entry: 1g25 (more details)

PDB Description: solution structure of the n-terminal domain of the human tfiih mat1 subunit
PDB Compounds: (A:) cdk-activating kinase assembly factor mat1

SCOPe Domain Sequences for d1g25a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]}
mddqgcprckttkyrnpslklmvnvcghtlcescvdllfvrgagncpecgtplrksnfrv
qlfed

SCOPe Domain Coordinates for d1g25a_:

Click to download the PDB-style file with coordinates for d1g25a_.
(The format of our PDB-style files is described here.)

Timeline for d1g25a_: