![]() | Class g: Small proteins [56992] (91 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
![]() | Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins) |
![]() | Protein Acute promyelocytic leukaemia proto-oncoprotein PML [57858] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57859] (1 PDB entry) |
![]() | Domain d1bora_: 1bor A: [45324] complexed with zn |
PDB Entry: 1bor (more details)
SCOPe Domain Sequences for d1bora_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} eeefqflrcqqcqaeakcpkllpclhtlcsgcleasgmqcpicqapwplgadtpal
Timeline for d1bora_: