SCOPe 2.05: Domain d1bora_: 1bor A:

Lineage for d1bora_ (1bor A:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)

6. Protein Acute promyelocytic leukaemia proto-oncoprotein PML [57858] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57859] (1 PDB entry)

8. Domain d1bora_: 1bor A: [45324]
   complexed with zn

Details for d1bora_

PDB Entry: 1bor

PDB Description: transcription factor pml, a proto-oncoprotein, nmr, 1 representative structure at ph 7.5, 30 c, in the presence of zinc

PDB Compounds: (A:) transcription factor pml

SCOPe Domain Sequences for d1bora_:

Sequence; same for both SEQRES and ATOM records:

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}
eeefqflrcqqcqaeakcpkllpclhtlcsgcleasgmqcpicqapwplgadtpal

Timeline for d1bora_:

• d1bora_ first appeared (with stable ids) in SCOP 1.55, called d1bor__
  
• d1bora_ appears in SCOPe 2.04
  
• d1bora_ appears in SCOPe 2.06
  
• d1bora_ appears in the current release, SCOPe 2.08