SCOPe 2.02: Domain d1rmda2: 1rmd A:1-86

Lineage for d1rmda2 (1rmd A:1-86)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.1: RING finger domain, C3HC4 [57851] (14 proteins)

6. Protein V(D)J recombination activating protein 1 (RAG1), dimerization domain [57854] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57855] (1 PDB entry)

8. Domain d1rmda2: 1rmd A:1-86 [45322]
   Other proteins in same PDB: d1rmda1
   include dimerization helices
   complexed with zn

Details for d1rmda2

PDB Entry: 1rmd, 2.1 Å

PDB Description: rag1 dimerization domain

PDB Compounds: (A:) rag1

SCOPe Domain Sequences for d1rmda2:

Sequence; same for both SEQRES and ATOM records:

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}
ncskihlstkllavdfpahfvksiscqicehiladpvetsckhlfcricilrclkvmgsy
cpscrypcfptdlespvksflnilns

Timeline for d1rmda2:

• d1rmda2 first appeared (with stable ids) in SCOP 1.55, called d1rmd_2
  
• d1rmda2 appears in SCOPe 2.01
  
• d1rmda2 appears in SCOPe 2.03
  
• d1rmda2 appears in the current release, SCOPe 2.08