Lineage for d1rmd_2 (1rmd 1-86)
- Root: SCOP 1.59
Class g: Small proteins [56992] (58 folds) 
Fold g.44: RING finger domain, C3HC4 [57849] (1 superfamily) Superfamily g.44.1: RING finger domain, C3HC4 [57850] (1 family) 
Family g.44.1.1: RING finger domain, C3HC4 [57851] (8 proteins) Protein V(D)J recombination activating protein 1 (RAG1), dimerization domain [57854] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [57855] (1 PDB entry) 
Domain d1rmd_2: 1rmd 1-86 [45322]
Other proteins in same PDB: d1rmd_1
Details for d1rmd_2
PDB Entry: 1rmd (more details), 2.1 Å
PDB Description: rag1 dimerization domain
SCOP Domain Sequences for d1rmd_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rmd_2 g.44.1.1 (1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus)}
ncskihlstkllavdfpahfvksiscqicehiladpvetsckhlfcricilrclkvmgsy
cpscrypcfptdlespvksflnilns
SCOP Domain Coordinates for d1rmd_2:
Click to download the PDB-style file with coordinates for d1rmd_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rmd_2:
- d1rmd_2 first appeared (with stable ids) in SCOP 1.55
- d1rmd_2 appears in SCOP 1.57
- d1rmd_2 appears in SCOP 1.61
- d1rmd_2 appears in the current release, SCOPe 2.08, called d1rmda2
View in 3D
