SCOP 1.59: Domain d1ezzb2: 1ezz B:101-153

Lineage for d1ezzb2 (1ezz B:101-153)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.41: Rubredoxin-like [57769] (9 superfamilies)

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family)

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (1 species)

7. Species Escherichia coli [TaxId:562] [57828] (26 PDB entries)

8. Domain d1ezzb2: 1ezz B:101-153 [45312]
   Other proteins in same PDB: d1ezza1, d1ezza2, d1ezzb1, d1ezzc1, d1ezzc2, d1ezzd1

Details for d1ezzb2

PDB Entry: 1ezz, 2.7 Å

PDB Description: crystal structure of e. coli aspartate transcarbamoylase p268a mutant in the t-state

SCOP Domain Sequences for d1ezzb2:

Sequence; same for both SEQRES and ATOM records:

>d1ezzb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d1ezzb2:

• d1ezzb2 first appeared (with stable ids) in SCOP 1.55
  
• d1ezzb2 appears in SCOP 1.57
  
• d1ezzb2 appears in SCOP 1.61
  
• d1ezzb2 appears in the current release, SCOPe 2.08