Lineage for d1ezzb2 (1ezz B:101-153)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41508Fold g.41: Rubredoxin-like [57769] (8 superfamilies)
  4. 41656Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 41657Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 41658Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (1 species)
  7. 41659Species Escherichia coli [TaxId:562] [57828] (25 PDB entries)
  8. 41705Domain d1ezzb2: 1ezz B:101-153 [45312]
    Other proteins in same PDB: d1ezza1, d1ezza2, d1ezzb1, d1ezzc1, d1ezzc2, d1ezzd1

Details for d1ezzb2

PDB Entry: 1ezz (more details), 2.7 Å

PDB Description: crystal structure of e. coli aspartate transcarbamoylase p268a mutant in the t-state

SCOP Domain Sequences for d1ezzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezzb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOP Domain Coordinates for d1ezzb2:

Click to download the PDB-style file with coordinates for d1ezzb2.
(The format of our PDB-style files is described here.)

Timeline for d1ezzb2: