Lineage for d1rahb2 (1rah B:101-153)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 204875Fold g.41: Rubredoxin-like [57769] (9 superfamilies)
  4. 205042Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 205043Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 205044Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (1 species)
  7. 205045Species Escherichia coli [TaxId:562] [57828] (26 PDB entries)
  8. 205076Domain d1rahb2: 1rah B:101-153 [45289]
    Other proteins in same PDB: d1raha1, d1raha2, d1rahb1, d1rahc1, d1rahc2, d1rahd1

Details for d1rahb2

PDB Entry: 1rah (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

SCOP Domain Sequences for d1rahb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rahb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOP Domain Coordinates for d1rahb2:

Click to download the PDB-style file with coordinates for d1rahb2.
(The format of our PDB-style files is described here.)

Timeline for d1rahb2: