SCOP 1.55: Domain d1rahb2: 1rah B:101-153

Lineage for d1rahb2 (1rah B:101-153)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.41: Rubredoxin-like [57769] (8 superfamilies)

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family)

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (1 species)

7. Species Escherichia coli [TaxId:562] [57828] (25 PDB entries)

8. Domain d1rahb2: 1rah B:101-153 [45289]
   Other proteins in same PDB: d1raha1, d1raha2, d1rahb1, d1rahc1, d1rahc2, d1rahd1

Details for d1rahb2

PDB Entry: 1rah, 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

SCOP Domain Sequences for d1rahb2:

Sequence; same for both SEQRES and ATOM records:

>d1rahb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d1rahb2:

• d1rahb2 appears in SCOP 1.57
  
• d1rahb2 appears in the current release, SCOPe 2.08