SCOP 1.69: Domain d1d66a1: 1d66 A:8-48

Lineage for d1d66a1 (1d66 A:8-48)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
   all-alpha dimetal(zinc)-bound fold

4. Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family)
   duplication: two structural repeats are related by the pseudo dyad

5. Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)

6. Protein Gal4 [57703] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57704] (2 PDB entries)

8. Domain d1d66a1: 1d66 A:8-48 [45076]
   Other proteins in same PDB: d1d66a2, d1d66b2

Details for d1d66a1

PDB Entry: 1d66, 2.7 Å

PDB Description: dna recognition by gal4: structure of a protein/dna complex

SCOP Domain Sequences for d1d66a1:

Sequence; same for both SEQRES and ATOM records:

>d1d66a1 g.38.1.1 (A:8-48) Gal4 {Baker's yeast (Saccharomyces cerevisiae)}
eqacdicrlkklkcskekpkcakclknnwecryspktkrsp

Timeline for d1d66a1:

• d1d66a1 first appeared (with stable ids) in SCOP 1.55
  
• d1d66a1 appears in SCOP 1.67
  
• d1d66a1 appears in SCOP 1.71
  
• d1d66a1 appears in the current release, SCOPe 2.08