Lineage for d1d66a1 (1d66 A:8-48)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41340Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
  4. 41341Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) (S)
  5. 41342Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)
  6. 41350Protein Gal4 [57703] (1 species)
  7. 41351Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57704] (2 PDB entries)
  8. 41352Domain d1d66a1: 1d66 A:8-48 [45076]
    Other proteins in same PDB: d1d66a2, d1d66b2

Details for d1d66a1

PDB Entry: 1d66 (more details), 2.7 Å

PDB Description: dna recognition by gal4: structure of a protein/dna complex

SCOP Domain Sequences for d1d66a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d66a1 g.38.1.1 (A:8-48) Gal4 {Baker's yeast (Saccharomyces cerevisiae)}
eqacdicrlkklkcskekpkcakclknnwecryspktkrsp

SCOP Domain Coordinates for d1d66a1:

Click to download the PDB-style file with coordinates for d1d66a1.
(The format of our PDB-style files is described here.)

Timeline for d1d66a1:

41352
d1d66a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1d66a2