| Class g: Small proteins [56992] (92 folds) |
| Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) ![]() |
| Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins) |
| Protein Transcription factor sp1 [57687] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57688] (4 PDB entries) |
| Domain d1sp2a_: 1sp2 A: [45050] finger 2 complexed with zn |
PDB Entry: 1sp2 (more details)
SCOPe Domain Sequences for d1sp2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]}
rpfmctwsycgkrftrsdelqrhkrthtgek
Timeline for d1sp2a_: