Lineage for d1sp2a_ (1sp2 A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1704720Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 1704721Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 1704722Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 1704809Protein Transcription factor sp1 [57687] (1 species)
  7. 1704810Species Human (Homo sapiens) [TaxId:9606] [57688] (4 PDB entries)
  8. 1704811Domain d1sp2a_: 1sp2 A: [45050]
    finger 2
    complexed with zn

Details for d1sp2a_

PDB Entry: 1sp2 (more details)

PDB Description: nmr structure of a zinc finger domain from transcription factor sp1f2, minimized average structure
PDB Compounds: (A:) sp1f2

SCOPe Domain Sequences for d1sp2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]}
rpfmctwsycgkrftrsdelqrhkrthtgek

SCOPe Domain Coordinates for d1sp2a_:

Click to download the PDB-style file with coordinates for d1sp2a_.
(The format of our PDB-style files is described here.)

Timeline for d1sp2a_: