Lineage for d4znfa_ (4znf A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065096Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 1065097Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (7 families) (S)
  5. 1065098Family g.37.1.1: Classic zinc finger, C2H2 [57668] (30 proteins)
  6. 1065107Protein Enhancer binding protein [57685] (1 species)
    duplication: consists of two Zn fingers
  7. 1065108Species Human (Homo sapiens) [TaxId:9606] [57686] (3 PDB entries)
  8. 1065111Domain d4znfa_: 4znf A: [45048]
    Single zinc finger
    complexed with zn

Details for d4znfa_

PDB Entry: 4znf (more details)

PDB Description: high-resolution three-dimensional structure of a single zinc finger from a human enhancer binding protein in solution
PDB Compounds: (A:) zinc finger

SCOPe Domain Sequences for d4znfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4znfa_ g.37.1.1 (A:) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]}
rpyhcsycnfsfktkgnltkhmkskahskk

SCOPe Domain Coordinates for d4znfa_:

Click to download the PDB-style file with coordinates for d4znfa_.
(The format of our PDB-style files is described here.)

Timeline for d4znfa_: