| Class g: Small proteins [56992] (90 folds) |
| Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (7 families) ![]() |
| Family g.37.1.1: Classic zinc finger, C2H2 [57668] (30 proteins) |
| Protein Enhancer binding protein [57685] (1 species) duplication: consists of two Zn fingers |
| Species Human (Homo sapiens) [TaxId:9606] [57686] (3 PDB entries) |
| Domain d4znfa_: 4znf A: [45048] Single zinc finger complexed with zn |
PDB Entry: 4znf (more details)
SCOPe Domain Sequences for d4znfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4znfa_ g.37.1.1 (A:) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]}
rpyhcsycnfsfktkgnltkhmkskahskk
Timeline for d4znfa_: