Class g: Small proteins [56992] (98 folds) |
Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily) folds around 4Fe-4S cluster |
Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) |
Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein) |
Protein HIPIP (high potential iron protein) [57654] (9 species) |
Species Thermochromatium tepidum [TaxId:1050] [57660] (11 PDB entries) |
Domain d1eyta_: 1eyt A: [44996] complexed with sf4 |
PDB Entry: 1eyt (more details), 1.5 Å
SCOPe Domain Sequences for d1eyta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eyta_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Thermochromatium tepidum [TaxId: 1050]} aapanavtaddptaialkynqdatkservaaarpglppeeqhcancqfmqanvgegdwkg cqlfpgklinvngwcaswtlkag
Timeline for d1eyta_: