SCOPe 2.06: Domain d1eyta_: 1eyt A:

Lineage for d1eyta_ (1eyt A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
   folds around 4Fe-4S cluster

4. Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family)

5. Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)

6. Protein HIPIP (high potential iron protein) [57654] (9 species)

7. Species Thermochromatium tepidum [TaxId:1050] [57660] (8 PDB entries)

8. Domain d1eyta_: 1eyt A: [44996]
   complexed with sf4

Details for d1eyta_

PDB Entry: 1eyt, 1.5 Å

PDB Description: crystal structure of high-potential iron-sulfur protein from thermochromatium tepidum

PDB Compounds: (A:) high-potential iron-sulfur protein

SCOPe Domain Sequences for d1eyta_:

Sequence; same for both SEQRES and ATOM records:

>d1eyta_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Thermochromatium tepidum [TaxId: 1050]}
aapanavtaddptaialkynqdatkservaaarpglppeeqhcancqfmqanvgegdwkg
cqlfpgklinvngwcaswtlkag

Timeline for d1eyta_:

• d1eyta_ first appeared (with stable ids) in SCOP 1.55
  
• d1eyta_ appears in SCOPe 2.05
  
• d1eyta_ appears in SCOPe 2.07
  
• d1eyta_ appears in the current release, SCOPe 2.08