Lineage for d1qlda1 (1qld A:21-69)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586143Fold g.29: Type X cellulose binding domain, CBDX [57614] (1 superfamily)
    disulfide-rich, alpha+beta
  4. 2586144Superfamily g.29.1: Type X cellulose binding domain, CBDX [57615] (1 family) (S)
  5. 2586145Family g.29.1.1: Type X cellulose binding domain, CBDX [57616] (1 protein)
  6. 2586146Protein Endo-1;4-beta-xylanase A CBDX [57617] (2 species)
  7. 2586149Species Pseudomonas fluorescens, subsp. cellulosa [TaxId:294] [57618] (2 PDB entries)
  8. 2586150Domain d1qlda1: 1qld A:21-69 [44961]
    Other proteins in same PDB: d1qlda2

Details for d1qlda1

PDB Entry: 1qld (more details)

PDB Description: solution structure of type x cbm
PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d1qlda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlda1 g.29.1.1 (A:21-69) Endo-1;4-beta-xylanase A CBDX {Pseudomonas fluorescens, subsp. cellulosa [TaxId: 294]}
gnqqcnwygtlyplcvtttngwgwedqrsciarstcaaqpapfgivgsg

SCOPe Domain Coordinates for d1qlda1:

Click to download the PDB-style file with coordinates for d1qlda1.
(The format of our PDB-style files is described here.)

Timeline for d1qlda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qlda2